1.67 Rating by CuteStat

newarkfingerprintingservices.com is 10 months 3 weeks old. It is a domain having .com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, newarkfingerprintingservices.com is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:


Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.


- mypickupday.com

  Not Applicable   $ 8.95


- decussatio.com

  Not Applicable   $ 8.95


- advocatesforcatholicschools.com

  Not Applicable   $ 8.95


- eucfa.com

  19,198,260   $ 8.95


- shiftelevation.com

  Not Applicable   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Sun, 20 Nov 2016 12:51:29 GMT
Content-Length: 367
Age: 1
Connection: keep-alive

Domain Information

Domain Registrar: GODADDY.COM, LLC
Registration Date: 2016-11-18 10 months 3 weeks 5 days ago
Last Modified: 2016-11-18 10 months 3 weeks 5 days ago
Expiration Date: 2018-11-18 1 year 3 weeks 3 days from now
Domain Status:

Domain Nameserver Information

Host IP Address Country
ns15.domaincontrol.com United States United States
ns16.domaincontrol.com United States United States

DNS Record Analysis

Host Type TTL Extra
newarkfingerprintingservices.com A 599 IP:
newarkfingerprintingservices.com NS 3599 Target: ns16.domaincontrol.com
newarkfingerprintingservices.com NS 3599 Target: ns15.domaincontrol.com
newarkfingerprintingservices.com SOA 599 MNAME: ns15.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2016111800
Refresh: 28800
Retry: 7200
Expire: 604800
newarkfingerprintingservices.com MX 3599 Priority: 10
Target: mailstore1.secureserver.net
newarkfingerprintingservices.com MX 3599 Target: smtp.secureserver.net

Similarly Ranked Websites


- google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

  1   $ 8,833,062,960.00

Discover - Google+

- plus.google.com

Discover amazing things and connect with passionate people.

  1   $ 8,833,062,960.00


- drive.google.com

  1   $ 8,833,062,960.00

Google Translate

- translate.google.com

Google's free service instantly translates words, phrases, and web pages between English and over 100 other languages.

  1   $ 8,833,062,960.00

Google News

- news.google.com

Comprehensive up-to-date news coverage, aggregated from sources all over the world by Google News.

  1   $ 8,833,062,960.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: newarkfingerprintingservices.com
Registrar URL: http://www.godaddy.com
Registrant Name: naimah muhammad
Registrant Organization:
DNSSEC: unsigned

For complete domain details go to:

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.

Comments / Ratings / Reviews / Feedbacks for newarkfingerprintingservices.com